Web stats for Homeandkitchenappliancesreview - homeandkitchenappliancesreview.com
Ultimate Guide to Buy Home and Kitchen Appliances - Reviews and Comparison
Traffic Report of Homeandkitchenappliancesreview
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
Where is homeandkitchenappliancesreview.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 14 |
Google Adsense: | Not Applicable | Google Analytics: | UA-56625592-2 |
Websites Hosted on Same IP (i.e. 198.252.106.234)
Cinema World Movies
cinemaworldmovies.com is providing you free access to all the latest movies for free. You can get every movie here for free.
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.5.38
Content-Type: text/html; charset=UTF-8
Link:
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Tue, 20 Jun 2017 06:31:23 GMT
Accept-Ranges: bytes
Server: LiteSpeed
Connection: close
Domain Information for homeandkitchenappliancesreview.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
homeandkitchenappliancesreview.com | A | 86400 |
IP:198.252.106.234 |
homeandkitchenappliancesreview.com | NS | 86400 |
Target:ns13.hawkhost.com |
homeandkitchenappliancesreview.com | NS | 86400 |
Target:ns14.hawkhost.com |
homeandkitchenappliancesreview.com | SOA | 86400 |
MNAME:ns13.hawkhost.com RNAME:server.hawkhost.com Serial:2017021413 Refresh:86400 Retry:7200 Expire:2419200 |
homeandkitchenappliancesreview.com | MX | 86400 |
Target:homeandkitchenappliancesreview.com |
homeandkitchenappliancesreview.com | TXT | 86400 |
TXT:v=spf1 +a +mx +ip4:198.252.106.85 +include:_spf.arandomserver.com ~all |
Similarly Ranked Websites to Homeandkitchenappliancesreview
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
Full WHOIS Lookup for homeandkitchenappliancesreview.com
Registry Domain ID: 2097609166_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2017-02-14T08:55:42.00Z
Creation Date: 2017-02-14T08:40:40.00Z
Registrar Registration Expiration Date: 2018-02-14T08:40:40.00Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: [email protected]
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: [email protected]
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: [email protected]
Name Server: ns13.hawkhost.com
Name Server: ns14.hawkhost.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2017-06-19T15:31:30.77Z